Lineage for d1qzrb2 (1qzr B:8-245)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610241Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 610242Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 610286Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 610313Protein DNA topoisomerase II [103226] (1 species)
  7. 610314Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103227] (2 PDB entries)
  8. 610318Domain d1qzrb2: 1qzr B:8-245 [96662]
    Other proteins in same PDB: d1qzra1, d1qzrb1
    complexed with anp, cdx, mg

Details for d1qzrb2

PDB Entry: 1qzr (more details), 1.9 Å

PDB Description: crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii bound to icrf-187 (dexrazoxane)

SCOP Domain Sequences for d1qzrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzrb2 d.122.1.2 (B:8-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae)}
asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkir

SCOP Domain Coordinates for d1qzrb2:

Click to download the PDB-style file with coordinates for d1qzrb2.
(The format of our PDB-style files is described here.)

Timeline for d1qzrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzrb1