Lineage for d1qzea3 (1qze A:232-283)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362436Fold a.189: XPC-binding domain of Rad23 homolog A (Hhr23a) [101237] (1 superfamily)
    4 helices; array
  4. 362437Superfamily a.189.1: XPC-binding domain of Rad23 homolog A (Hhr23a) [101238] (1 family) (S)
  5. 362438Family a.189.1.1: XPC-binding domain of Rad23 homolog A (Hhr23a) [101239] (1 protein)
  6. 362439Protein XPC-binding domain of Rad23 homolog A (Hhr23a) [101240] (1 species)
  7. 362440Species Human (Homo sapiens) [TaxId:9606] [101241] (2 PDB entries)
  8. 362442Domain d1qzea3: 1qze A:232-283 [96631]
    Other proteins in same PDB: d1qzea1, d1qzea2, d1qzea4

Details for d1qzea3

PDB Entry: 1qze (more details)

PDB Description: HHR23a protein structure based on residual dipolar coupling data

SCOP Domain Sequences for d1qzea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzea3 a.189.1.1 (A:232-283) XPC-binding domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens)}
leflrdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqm

SCOP Domain Coordinates for d1qzea3:

Click to download the PDB-style file with coordinates for d1qzea3.
(The format of our PDB-style files is described here.)

Timeline for d1qzea3: