Lineage for d1qzda_ (1qzd A:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710486Domain d1qzda_: 1qzd A: [96628]
    EF-Tu/kirromycin model fitted into the cryo-EM map of EF-Tu ternary complex

Details for d1qzda_

PDB Entry: 1qzd (more details), 10 Å

PDB Description: ef-tu.kirromycin coordinates fitted into the cryo-em map of ef-tu ternary complex (gdp.kirromycin) bound 70s ribosome
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1qzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzda_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
tlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d1qzda_:

Click to download the PDB-style file with coordinates for d1qzda_.
(The format of our PDB-style files is described here.)

Timeline for d1qzda_: