Lineage for d1qyua_ (1qyu A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881678Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 881679Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 881719Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 881724Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species)
  7. 881725Species Escherichia coli [TaxId:562] [103020] (3 PDB entries)
    Uniprot P33643
  8. 881728Domain d1qyua_: 1qyu A: [96604]

Details for d1qyua_

PDB Entry: 1qyu (more details), 2 Å

PDB Description: Structure of the catalytic domain of 23S rRNA pseudouridine synthase RluD
PDB Compounds: (A:) Ribosomal large subunit pseudouridine synthase D

SCOP Domain Sequences for d1qyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyua_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]}
fepqdipldivyedediiiinkprdlvvhpgagnpdgtvlnallhyyppiadvpragivh
rldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkr
thmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggr
prppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmradf
eehkdevdwl

SCOP Domain Coordinates for d1qyua_:

Click to download the PDB-style file with coordinates for d1qyua_.
(The format of our PDB-style files is described here.)

Timeline for d1qyua_: