Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins) contains N-terminal alpha-L RNA-binding motif |
Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species) |
Species Escherichia coli [TaxId:562] [103020] (3 PDB entries) Uniprot P33643 |
Domain d1qyua_: 1qyu A: [96604] |
PDB Entry: 1qyu (more details), 2 Å
SCOPe Domain Sequences for d1qyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qyua_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]} fepqdipldivyedediiiinkprdlvvhpgagnpdgtvlnallhyyppiadvpragivh rldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkr thmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggr prppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmradf eehkdevdwl
Timeline for d1qyua_: