Lineage for d1qyhb_ (1qyh B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417809Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 417810Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 417811Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 417812Protein HSP90 [55876] (3 species)
  7. 417822Species Dog (Canis familiaris) [TaxId:9615] [103225] (4 PDB entries)
  8. 417827Domain d1qyhb_: 1qyh B: [96594]
    complexed with nec

Details for d1qyhb_

PDB Entry: 1qyh (more details), 2.1 Å

PDB Description: Crystal Structure of the N-domain of GRP94 lacking the charged domain in Complex with NECA

SCOP Domain Sequences for d1qyhb_:

Sequence, based on SEQRES records: (download)

>d1qyhb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris)}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
keeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1qyhb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris)}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
keeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOP Domain Coordinates for d1qyhb_:

Click to download the PDB-style file with coordinates for d1qyhb_.
(The format of our PDB-style files is described here.)

Timeline for d1qyhb_:

  • d1qyhb_ is new in SCOP 1.67
  • d1qyhb_ became obsolete in SCOP 1.69