SCOP 1.67: Domain d1qyba2: 1qyb A:148-191

Lineage for d1qyba2 (1qyb A:148-191)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.1: Rubredoxin [57803] (3 proteins)

6. Protein Rubrerythrin, C-terminal domain [57811] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [57812] (8 PDB entries)

8. Domain d1qyba2: 1qyb A:148-191 [96580]
   Other proteins in same PDB: d1qyba1
   complexed with fe, so4, zn

Details for d1qyba2

PDB Entry: 1qyb, 1.75 Å

PDB Description: X-ray crystal structure of Desulfovibrio vulgaris rubrerythrin with zinc substituted into the [Fe(SCys)4] site and alternative diiron site structures

SCOP Domain Sequences for d1qyba2:

Sequence; same for both SEQRES and ATOM records:

>d1qyba2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

Timeline for d1qyba2:

• d1qyba2 is new in SCOP 1.67
  
• d1qyba2 appears in SCOP 1.69
  
• d1qyba2 appears in the current release, SCOPe 2.08