| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
| Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries) Uniprot P24931 |
| Domain d1qyba1: 1qyb A:2-147 [96579] Other proteins in same PDB: d1qyba2 complexed with fe, so4, zn |
PDB Entry: 1qyb (more details), 1.75 Å
SCOPe Domain Sequences for d1qyba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qyba1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv
Timeline for d1qyba1: