Lineage for d1qxsd1 (1qxs D:1-164,D:334-359)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575246Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 575401Species Trypanosoma cruzi [TaxId:5693] [75104] (3 PDB entries)
  8. 575413Domain d1qxsd1: 1qxs D:1-164,D:334-359 [96560]
    Other proteins in same PDB: d1qxsa2, d1qxsb2, d1qxsc2, d1qxsd2
    complexed with nad, s70

Details for d1qxsd1

PDB Entry: 1qxs (more details), 2.75 Å

PDB Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid

SCOP Domain Sequences for d1qxsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxsd1 c.2.1.3 (D:1-164,D:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

SCOP Domain Coordinates for d1qxsd1:

Click to download the PDB-style file with coordinates for d1qxsd1.
(The format of our PDB-style files is described here.)

Timeline for d1qxsd1: