SCOP 1.67: Domain d1qxsc1: 1qxs C:1-164,C:334-359

Lineage for d1qxsc1 (1qxs C:1-164,C:334-359)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75104] (3 PDB entries)

8. Domain d1qxsc1: 1qxs C:1-164,C:334-359 [96558]
   Other proteins in same PDB: d1qxsa2, d1qxsb2, d1qxsc2, d1qxsd2

Details for d1qxsc1

PDB Entry: 1qxs, 2.75 Å

PDB Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid

SCOP Domain Sequences for d1qxsc1:

Sequence; same for both SEQRES and ATOM records:

>d1qxsc1 c.2.1.3 (C:1-164,C:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

Timeline for d1qxsc1:

• d1qxsc1 is new in SCOP 1.67
  
• d1qxsc1 appears in SCOP 1.69
  
• d1qxsc1 appears in the current release, SCOPe 2.08