Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species) |
Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries) |
Domain d1qxsb2: 1qxs B:165-333 [96557] Other proteins in same PDB: d1qxsa1, d1qxsb1, d1qxsc1, d1qxsd1 complexed with nad, s70 |
PDB Entry: 1qxs (more details), 2.75 Å
SCOPe Domain Sequences for d1qxsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxsb2 d.81.1.1 (B:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy
Timeline for d1qxsb2: