![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) |
![]() | Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (6 PDB entries) |
![]() | Domain d1qxpb1: 1qxp B:710-893 [96547] Other proteins in same PDB: d1qxpa2, d1qxpa3, d1qxpa4, d1qxpb2, d1qxpb3, d1qxpb4 mu-like isoform with the large and small subunits fused in a single chain mutant |
PDB Entry: 1qxp (more details), 2.8 Å
SCOP Domain Sequences for d1qxpb1:
Sequence, based on SEQRES records: (download)
>d1qxpb1 a.39.1.8 (B:710-893) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus) [TaxId: 10116]} mhysnieaneseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc rsmvavmdsdttgklgfeefkylwnnikkwqgiykrfetdrsgtigsnelpgafeaagfh lnqhiysmiirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlql tmys
>d1qxpb1 a.39.1.8 (B:710-893) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus) [TaxId: 10116]} mhysnneseerqfrklfvqlmevsatelmfgidtcrsmvavmdsdttgklgfeefkylwn nikkwqgirfetdrsgpgafeaagfhlnqhiysmiirsdetgnmdfdnfisclvrldamf rafrsldkngtgqiqvniqewlqltmys
Timeline for d1qxpb1:
![]() Domains from other chains: (mouse over for more information) d1qxpa1, d1qxpa2, d1qxpa3, d1qxpa4 |