Lineage for d1qwva_ (1qwv A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 641396Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 641397Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 641398Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 641399Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (2 PDB entries)
  8. 641400Domain d1qwva_: 1qwv A: [96506]

Details for d1qwva_

PDB Entry: 1qwv (more details)

PDB Description: solution structure of antheraea polyphemus pheromone binding protein (apolpbp)
PDB Compounds: (A:) pheromone-binding protein

SCOP Domain Sequences for d1qwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwva_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

SCOP Domain Coordinates for d1qwva_:

Click to download the PDB-style file with coordinates for d1qwva_.
(The format of our PDB-style files is described here.)

Timeline for d1qwva_: