Lineage for d1qwna3 (1qwn A:31-411)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389505Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 389541Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (4 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 389542Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 389543Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 389544Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (7 PDB entries)
  8. 389545Domain d1qwna3: 1qwn A:31-411 [96489]
    Other proteins in same PDB: d1qwna1, d1qwna2
    complexed with gul, mpd, nag, trs, zn

Details for d1qwna3

PDB Entry: 1qwn (more details), 1.2 Å

PDB Description: golgi alpha-mannosidase ii covalent intermediate complex with 5- fluoro-gulosyl-fluoride

SCOP Domain Sequences for d1qwna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwna3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

SCOP Domain Coordinates for d1qwna3:

Click to download the PDB-style file with coordinates for d1qwna3.
(The format of our PDB-style files is described here.)

Timeline for d1qwna3: