Lineage for d1qw9b1 (1qw9 B:5-17,B:385-501)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1328311Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 1328312Protein Alpha-l-arabinofuranosidase [101924] (2 species)
    glycosyl hydrolase family 51
  7. 1328313Species Bacillus stearothermophilus [TaxId:1422] [101925] (4 PDB entries)
  8. 1328315Domain d1qw9b1: 1qw9 B:5-17,B:385-501 [96468]
    Other proteins in same PDB: d1qw9a2, d1qw9b2
    complexed with khp

Details for d1qw9b1

PDB Entry: 1qw9 (more details), 1.2 Å

PDB Description: crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with 4-nitrophenyl-ara
PDB Compounds: (B:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d1qw9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw9b1 b.71.1.2 (B:5-17,B:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]}
katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm
edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp
klswnvirlgk

SCOPe Domain Coordinates for d1qw9b1:

Click to download the PDB-style file with coordinates for d1qw9b1.
(The format of our PDB-style files is described here.)

Timeline for d1qw9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qw9b2