![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
![]() | Protein Alpha-l-arabinofuranosidase [101924] (2 species) glycosyl hydrolase family 51 |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [101925] (5 PDB entries) |
![]() | Domain d1qw9a1: 1qw9 A:5-17,A:385-501 [96466] Other proteins in same PDB: d1qw9a2, d1qw9b2 complexed with khp |
PDB Entry: 1qw9 (more details), 1.2 Å
SCOPe Domain Sequences for d1qw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qw9a1 b.71.1.2 (A:5-17,A:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]} katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp klswnvirlgk
Timeline for d1qw9a1: