SCOP 1.73: Domain d1qw8a2: 1qw8 A:18-384

Lineage for d1qw8a2 (1qw8 A:18-384)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (24 proteins)
   consist of a number of sequence families

6. Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
   glycosyl hydrolase family 51

7. Species Bacillus stearothermophilus [TaxId:1422] [102076] (4 PDB entries)

8. Domain d1qw8a2: 1qw8 A:18-384 [96463]
   Other proteins in same PDB: d1qw8a1, d1qw8b1

Details for d1qw8a2

PDB Entry: 1qw8, 1.8 Å

PDB Description: crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl

PDB Compounds: (A:) alpha-l-arabinofuranosidase

SCOP Domain Sequences for d1qw8a2:

Sequence; same for both SEQRES and ATOM records:

>d1qw8a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
eidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelqvpiirypggnfvs
gynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevnmavnlgtrgidaa
rnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqighktaveygriacea
akvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislhqyygnrdndtany
lalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsneadkliepwtvappl
lediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekngpawkqtiyypfm
hasvygr

Timeline for d1qw8a2:

• d1qw8a2 first appeared in SCOP 1.67
  
• d1qw8a2 appears in SCOP 1.71
  
• d1qw8a2 appears in SCOP 1.75
  
• d1qw8a2 appears in the current release, SCOPe 2.08