SCOPe 2.07: Domain d1qw8a1: 1qw8 A:5-17,A:385-501

Lineage for d1qw8a1 (1qw8 A:5-17,A:385-501)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Alpha-l-arabinofuranosidase [101924] (2 species)
   glycosyl hydrolase family 51

7. Species Bacillus stearothermophilus [TaxId:1422] [101925] (5 PDB entries)

8. Domain d1qw8a1: 1qw8 A:5-17,A:385-501 [96462]
   Other proteins in same PDB: d1qw8a2, d1qw8b2
   complexed with kho

Details for d1qw8a1

PDB Entry: 1qw8, 1.8 Å

PDB Description: crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl

PDB Compounds: (A:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d1qw8a1:

Sequence; same for both SEQRES and ATOM records:

>d1qw8a1 b.71.1.2 (A:5-17,A:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]}
katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm
edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp
klswnvirlgk

Timeline for d1qw8a1:

• d1qw8a1 first appeared in SCOP 1.67
  
• d1qw8a1 appears in SCOPe 2.06
  
• d1qw8a1 appears in the current release, SCOPe 2.08