Lineage for d1qviz_ (1qvi Z:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 769024Protein Myosin Regulatory Chain [47527] (2 species)
  7. 769025Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries)
    Uniprot P07291
  8. 769028Domain d1qviz_: 1qvi Z: [96430]
    Other proteins in same PDB: d1qvia1, d1qvia2, d1qviy_
    complexed with adp, ca, mg, vo4

Details for d1qviz_

PDB Entry: 1qvi (more details), 2.54 Å

PDB Description: Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head
PDB Compounds: (Z:) myosin essential light chain, striated adductor muscle

SCOP Domain Sequences for d1qviz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qviz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypd

SCOP Domain Coordinates for d1qviz_:

Click to download the PDB-style file with coordinates for d1qviz_.
(The format of our PDB-style files is described here.)

Timeline for d1qviz_: