Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Myosin Regulatory Chain [47527] (2 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries) Uniprot P07291 |
Domain d1qviz_: 1qvi Z: [96430] Other proteins in same PDB: d1qvia1, d1qvia2, d1qviy_ complexed with adp, ca, mg, vo4 |
PDB Entry: 1qvi (more details), 2.54 Å
SCOP Domain Sequences for d1qviz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qviz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde dvdeiikltdlqedlegnvkyedfvkkvmagpypd
Timeline for d1qviz_: