Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
Domain d1qvhi_: 1qvh I: [96423] Other proteins in same PDB: d1qvh.1, d1qvh.2, d1qvhg_, d1qvhh_, d1qvhj_, d1qvhk_ central region only |
PDB Entry: 1qvh (more details), 3.65 Å
SCOP Domain Sequences for d1qvhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvhi_ h.1.8.1 (I:) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} dnccilderfgsycpttcgiadflstyqtkvdkdlqsled
Timeline for d1qvhi_: