Lineage for d1qvh.2 (1qvh D:,E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670861Protein Thrombin [50531] (2 species)
  7. 670908Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries)
  8. 671088Domain d1qvh.2: 1qvh D:,E: [96420]
    Other proteins in same PDB: d1qvhg_, d1qvhh_, d1qvhi_, d1qvhj_, d1qvhk_, d1qvhl_
    complexed with po4

Details for d1qvh.2

PDB Entry: 1qvh (more details), 3.65 Å

PDB Description: crystal structure of the complex between thrombin and the central "e" region of fibrin
PDB Compounds: (D:) Thrombin light chain, (E:) Thrombin heavy chain

SCOP Domain Sequences for d1qvh.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qvh.2 b.47.1.2 (D:,E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
geadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqell
cgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyih
prynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlket
wtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsgg
pfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOP Domain Coordinates for d1qvh.2:

Click to download the PDB-style file with coordinates for d1qvh.2.
(The format of our PDB-style files is described here.)

Timeline for d1qvh.2: