Lineage for d1qvgz_ (1qvg Z:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263613Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 2263614Protein Ribosomal protein L37e [57834] (1 species)
  7. 2263615Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 2263642Domain d1qvgz_: 1qvg Z: [96418]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgz_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1qvgz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgz_ g.41.8.2 (Z:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1qvgz_:

Click to download the PDB-style file with coordinates for d1qvgz_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgz_: