Lineage for d1qvgy_ (1qvg Y:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524416Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 524417Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 524418Protein Ribosomal protein L37ae [57831] (1 species)
  7. 524419Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (19 PDB entries)
  8. 524434Domain d1qvgy_: 1qvg Y: [96417]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgz_

Details for d1qvgy_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgy_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1qvgy_:

Click to download the PDB-style file with coordinates for d1qvgy_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgy_: