Lineage for d1qvgs_ (1qvg S:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461603Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 461604Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 461626Protein Ribosomal proteins L24 (L24p) [50106] (1 species)
  7. 461627Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (19 PDB entries)
  8. 461642Domain d1qvgs_: 1qvg S: [96411]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_

Details for d1qvgs_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgs_ b.34.5.1 (S:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d1qvgs_:

Click to download the PDB-style file with coordinates for d1qvgs_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgs_: