SCOP 1.67: Domain d1qvgo_: 1qvg O:

Lineage for d1qvgo_ (1qvg O:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (18 PDB entries)

8. Domain d1qvgo_: 1qvg O: [96407]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvgo_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgo_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgo_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d1qvgo_:

• d1qvgo_ is new in SCOP 1.67
  
• d1qvgo_ appears in SCOP 1.69
  
• d1qvgo_ appears in the current release, SCOPe 2.08