Lineage for d1qvgm_ (1qvg M:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488796Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 488797Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 488798Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 488799Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries)
  8. 488814Domain d1qvgm_: 1qvg M: [96405]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_

Details for d1qvgm_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgm_ c.55.4.1 (M:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1qvgm_:

Click to download the PDB-style file with coordinates for d1qvgm_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgm_: