Lineage for d1qvge1 (1qvg E:1-79)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611499Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 611500Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 611501Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 611502Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 611503Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (19 PDB entries)
  8. 611532Domain d1qvge1: 1qvg E:1-79 [96396]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_

Details for d1qvge1

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvge1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1qvge1:

Click to download the PDB-style file with coordinates for d1qvge1.
(The format of our PDB-style files is described here.)

Timeline for d1qvge1: