| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix automatically mapped to Pfam PF00832 |
| Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
| Protein Ribosomal protein L39e [48664] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
| Domain d1qvg1_: 1qvg 1: [96389] Other proteins in same PDB: d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1qvg (more details), 2.9 Å
SCOPe Domain Sequences for d1qvg1_:
Sequence, based on SEQRES records: (download)
>d1qvg1_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
>d1qvg1_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
Timeline for d1qvg1_:
View in 3DDomains from other chains: (mouse over for more information) d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_ |