Lineage for d1qvfy_ (1qvf Y:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430415Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 430416Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 430417Protein Ribosomal protein L37ae [57831] (1 species)
  7. 430418Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (18 PDB entries)
  8. 430426Domain d1qvfy_: 1qvf Y: [96387]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfy_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfy_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1qvfy_:

Click to download the PDB-style file with coordinates for d1qvfy_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfy_: