Lineage for d1qvfx_ (1qvf X:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389955Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 389984Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 389985Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 389986Protein Ribosomal protein L32e [52044] (1 species)
  7. 389987Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (18 PDB entries)
  8. 389995Domain d1qvfx_: 1qvf X: [96386]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfx_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfx_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1qvfx_:

Click to download the PDB-style file with coordinates for d1qvfx_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfx_: