SCOPe 2.08: Domain d1qvfx_: 1qvf X:

Lineage for d1qvfx_ (1qvf X:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d1qvfx_: 1qvf X: [96386]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfy_, d1qvfz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvfx_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1qvfx_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfx_ c.9.2.1 (X:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1qvfx_:

• d1qvfx_ first appeared in SCOP 1.67
  
• d1qvfx_ appears in SCOPe 2.07