Lineage for d1qvfs_ (1qvf S:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372810Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 372811Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 372832Protein Ribosomal proteins L24 (L24p) [50106] (1 species)
  7. 372833Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (18 PDB entries)
  8. 372841Domain d1qvfs_: 1qvf S: [96381]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfs_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfs_ b.34.5.1 (S:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d1qvfs_:

Click to download the PDB-style file with coordinates for d1qvfs_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfs_: