Lineage for d1qvfr_ (1qvf R:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716452Family d.12.1.1: L23p [54190] (1 protein)
  6. 716453Protein Ribosomal protein L23 [54191] (2 species)
  7. 716454Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)
  8. 716492Domain d1qvfr_: 1qvf R: [96380]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfr_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1qvfr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfr_ d.12.1.1 (R:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1qvfr_:

Click to download the PDB-style file with coordinates for d1qvfr_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfr_: