Lineage for d1qvfo_ (1qvf O:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358614Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 358615Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 358616Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 358617Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 358618Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (18 PDB entries)
  8. 358626Domain d1qvfo_: 1qvf O: [96377]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfo_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfo_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1qvfo_:

Click to download the PDB-style file with coordinates for d1qvfo_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfo_: