![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L18e [52084] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (18 PDB entries) |
![]() | Domain d1qvfn_: 1qvf N: [96376] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOP Domain Sequences for d1qvfn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvfn_ c.12.1.1 (N:) Ribosomal protein L18e {Archaeon Haloarcula marismortui} sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d1qvfn_:
![]() Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ |