Lineage for d1qvfj_ (1qvf J:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949112Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 949113Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 949114Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 949115Protein Ribosomal protein L14 [50195] (5 species)
  7. 949159Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 949191Domain d1qvfj_: 1qvf J: [96372]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvfj_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1qvfj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfj_ b.39.1.1 (J:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1qvfj_:

Click to download the PDB-style file with coordinates for d1qvfj_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfj_: