Lineage for d1qvfj_ (1qvf J:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373873Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 373874Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 373875Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 373876Protein Ribosomal protein L14 [50195] (2 species)
  7. 373877Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (18 PDB entries)
  8. 373885Domain d1qvfj_: 1qvf J: [96372]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfj_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfj_ b.39.1.1 (J:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1qvfj_:

Click to download the PDB-style file with coordinates for d1qvfj_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfj_: