Lineage for d1qvfg_ (1qvf G:)

  1. Root: SCOP 1.71
  2. 629440Class j: Peptides [58231] (116 folds)
  3. 630773Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 630774Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 630775Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 630776Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 630777Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (18 PDB entries)
  8. 630785Domain d1qvfg_: 1qvf G: [96369]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfg_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfg_:

Sequence, based on SEQRES records: (download)

>d1qvfg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1qvfg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1qvfg_:

Click to download the PDB-style file with coordinates for d1qvfg_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfg_: