Lineage for d1qvfe1 (1qvf E:1-79)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511639Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 511640Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 511641Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 511642Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 511643Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (19 PDB entries)
  8. 511660Domain d1qvfe1: 1qvf E:1-79 [96366]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_

Details for d1qvfe1

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1qvfe1:

Click to download the PDB-style file with coordinates for d1qvfe1.
(The format of our PDB-style files is described here.)

Timeline for d1qvfe1: