Lineage for d1qvfb_ (1qvf B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669648Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 669649Protein Ribosomal protein L3 [50462] (1 species)
    superfamily fold is elaborated with additional structures
  7. 669650Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries)
  8. 669688Domain d1qvfb_: 1qvf B: [96363]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfb_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOP Domain Sequences for d1qvfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfb_ b.43.3.2 (B:) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d1qvfb_:

Click to download the PDB-style file with coordinates for d1qvfb_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfb_: