SCOPe 2.07: Domain d1qvf2_: 1qvf 2:

Lineage for d1qvf2_ (1qvf 2:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1qvf2_: 1qvf 2: [96360]
   Other proteins in same PDB: d1qvf1_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvf2_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (2:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1qvf2_:

Sequence; same for both SEQRES and ATOM records:

>d1qvf2_ g.41.8.3 (2:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1qvf2_:

• d1qvf2_ first appeared in SCOP 1.67
  
• d1qvf2_ appears in SCOPe 2.06
  
• d1qvf2_ appears in the current release, SCOPe 2.08