Lineage for d1qewa2 (1qew A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544831Domain d1qewa2: 1qew A:1-181 [96342]
    Other proteins in same PDB: d1qewa1, d1qewb1, d1qewb2

Details for d1qewa2

PDB Entry: 1qew (more details), 2.2 Å

PDB Description: human class i histocompatibility antigen (hla-a 0201) complex with a nonameric peptide from melanoma-associated antigen 3 (residues 271- 279)
PDB Compounds: (A:) protein (hla class I histocompatibility antigen, b-35 b* 3501 alpha chain)

SCOPe Domain Sequences for d1qewa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qewa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1qewa2:

Click to download the PDB-style file with coordinates for d1qewa2.
(The format of our PDB-style files is described here.)

Timeline for d1qewa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qewa1