Lineage for d1q9xd2 (1q9x D:376-903)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743032Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 743110Protein Family B DNA polymerase [56680] (7 species)
  7. 743121Species Bacteriophage RB69 [TaxId:12353] [56681] (10 PDB entries)
  8. 743140Domain d1q9xd2: 1q9x D:376-903 [96335]
    Other proteins in same PDB: d1q9xa1, d1q9xb1, d1q9xc1, d1q9xd1
    complexed with 3dr, ca, dgp, doc; mutant

Details for d1q9xd2

PDB Entry: 1q9x (more details), 2.69 Å

PDB Description: crystal structure of enterobacteria phage rb69 gp43 dna polymerase complexed with tetrahydrofuran containing dna
PDB Compounds: (D:) DNA polymerase

SCOP Domain Sequences for d1q9xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9xd2 e.8.1.1 (D:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOP Domain Coordinates for d1q9xd2:

Click to download the PDB-style file with coordinates for d1q9xd2.
(The format of our PDB-style files is described here.)

Timeline for d1q9xd2: