Lineage for d1q9wd2 (1q9w D:112-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655370Domain d1q9wd2: 1q9w D:112-213 [96327]
    Other proteins in same PDB: d1q9wa1, d1q9wa2, d1q9wb1, d1q9wc1, d1q9wc2, d1q9wd1
    part of Fab s45-18
    complexed with gp1, gp4, kdo, mg

Details for d1q9wd2

PDB Entry: 1q9w (more details), 1.75 Å

PDB Description: s45-18 fab pentasaccharide bisphosphate complex
PDB Compounds: (D:) S45-18 Fab (IgG1k) heavy chain

SCOP Domain Sequences for d1q9wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9wd2 b.1.1.2 (D:112-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1q9wd2:

Click to download the PDB-style file with coordinates for d1q9wd2.
(The format of our PDB-style files is described here.)

Timeline for d1q9wd2: