SCOP 1.73: Domain d1q9wd1: 1q9w D:1-111

Lineage for d1q9wd1 (1q9w D:1-111)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (43 PDB entries)

8. Domain d1q9wd1: 1q9w D:1-111 [96326]
   Other proteins in same PDB: d1q9wa1, d1q9wa2, d1q9wb2, d1q9wc1, d1q9wc2, d1q9wd2
   part of Fab s45-18
   complexed with gp1, gp4, kdo, mg

Details for d1q9wd1

PDB Entry: 1q9w, 1.75 Å

PDB Description: s45-18 fab pentasaccharide bisphosphate complex

PDB Compounds: (D:) S45-18 Fab (IgG1k) heavy chain

SCOP Domain Sequences for d1q9wd1:

Sequence; same for both SEQRES and ATOM records:

>d1q9wd1 b.1.1.1 (D:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
tvss

Timeline for d1q9wd1:

• d1q9wd1 first appeared in SCOP 1.67
  
• d1q9wd1 appears in SCOP 1.71
  
• d1q9wd1 appears in SCOP 1.75
  
• d1q9wd1 appears in the current release, SCOPe 2.08