Lineage for d1q9vb2 (1q9v B:112-211)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453409Domain d1q9vb2: 1q9v B:112-211 [96319]
    Other proteins in same PDB: d1q9va1, d1q9va2, d1q9vb1
    part of Fab s25-2

Details for d1q9vb2

PDB Entry: 1q9v (more details), 1.73 Å

PDB Description: S25-2- Kdo monosaccharide complex

SCOP Domain Sequences for d1q9vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9vb2 b.1.1.2 (B:112-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1q9vb2:

Click to download the PDB-style file with coordinates for d1q9vb2.
(The format of our PDB-style files is described here.)

Timeline for d1q9vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9vb1