SCOP 1.73: Domain d1q9tb2: 1q9t B:112-213

Lineage for d1q9tb2 (1q9t B:112-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1q9tb2: 1q9t B:112-213 [96313]
   Other proteins in same PDB: d1q9ta1, d1q9ta2, d1q9tb1
   part of Fab s25-2
   complexed with kda, kdo, mg, zn

Details for d1q9tb2

PDB Entry: 1q9t, 1.74 Å

PDB Description: S25-2- a(2-4)Kdo disaccharide complex

PDB Compounds: (B:) S25-2 Fab (IgG1k) heavy chain

SCOP Domain Sequences for d1q9tb2:

Sequence; same for both SEQRES and ATOM records:

>d1q9tb2 b.1.1.2 (B:112-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1q9tb2:

• d1q9tb2 first appeared in SCOP 1.67
  
• d1q9tb2 appears in SCOP 1.71
  
• d1q9tb2 last appears in SCOP 1.75