Lineage for d1q9sa_ (1q9s A:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) 
Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins) Protein Riboflavin kinase [82116] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [89338] (4 PDB entries)
encoded by FLJ11149
Domain d1q9sa_: 1q9s A: [96309]
complexed with adp, fmn, mg
Details for d1q9sa_
PDB Entry: 1q9s (more details), 2.42 Å
PDB Description: Crystal structure of riboflavin kinase with ternary product complex
SCOP Domain Sequences for d1q9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9sa_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens)}
imrhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvh
kmvvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisai
qgdieeakkrlelpeylkikednffqvsk
SCOP Domain Coordinates for d1q9sa_:
Click to download the PDB-style file with coordinates for d1q9sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q9sa_:
- d1q9sa_ is new in SCOP 1.67
- d1q9sa_ appears in SCOP 1.69
- d1q9sa_ appears in the current release, SCOPe 2.08
View in 3D