Lineage for d1q9ra2 (1q9r A:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656136Domain d1q9ra2: 1q9r A:108-213 [96306]
    Other proteins in same PDB: d1q9ra1, d1q9rb1, d1q9rb2
    part of Fab s25-2
    complexed with kda, kdo, mg, zn

Details for d1q9ra2

PDB Entry: 1q9r (more details), 1.45 Å

PDB Description: S25-2- a(2-8)Kdo disaccharide complex
PDB Compounds: (A:) S25-2 Fab (IgG1k) light chain

SCOP Domain Sequences for d1q9ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ra2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1q9ra2:

Click to download the PDB-style file with coordinates for d1q9ra2.
(The format of our PDB-style files is described here.)

Timeline for d1q9ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9ra1