SCOP 1.67: Domain d1q9od2: 1q9o D:112-213

Lineage for d1q9od2 (1q9o D:112-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1q9od2: 1q9o D:112-213 [96299]
   Other proteins in same PDB: d1q9oa1, d1q9oa2, d1q9ob1, d1q9oc1, d1q9oc2, d1q9od1
   part of Fab s45-18
   complexed with mg

Details for d1q9od2

PDB Entry: 1q9o, 1.79 Å

PDB Description: S45-18 Fab Unliganded

SCOP Domain Sequences for d1q9od2:

Sequence; same for both SEQRES and ATOM records:

>d1q9od2 b.1.1.2 (D:112-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1q9od2:

• d1q9od2 is new in SCOP 1.67
  
• d1q9od2 appears in SCOP 1.69
  
• d1q9od2 appears in the current release, SCOPe 2.08